HORDB

ID: hor006084
Uniprot ID: O44185
Protein name: SDRPTRAMDSPLIRF-amide
Gene name: flp-13
Organism: Caenorhabditis elegans
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Expressed from the comma stage of embryogenesis, during all larval stages, and in low levels in adults . |Expressed in the ASE sensory neurons, the DD motor neurons, the 15, M3 and M5 cholinergic pharyngeal motoneurons, and the ASG, ASK and BAG neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045187 regulation of circadian sleep/wake cycle, sleep; GO:1900034 regulation of cellular response to heat
GO CC: GO:0005576 extracellular region

Sequence: SDRPTRAMDSPLIRF
Length: 15
Propeptide: MMTSLLTISMFVVAIQAFDSSEIRMLDEQYDTKNPFFQFLENSKRSDRPTRAMDSPLIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAADGAPLIRFGRAPEASPFIRFGKRASPSAPLIRFGRSPSAVPLIRFGRSAAAPLIRFGRASSAPLIRFGRK
Signal peptide: MMTSLLTISMFVVAIQA
Modification: T15 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Probable FMRFamide-like neuropeptides (PubMed:28094002, PubMed:16377032). Binds to neuronal receptors such as dmsr-1 to promote sleep in response to cellular stress also known as stress-induced sleep (SIS) (PubMed:28094002). Plays a role in behaviors associated with SIS, acting in concert with the FMRFamide related peptide, flp-24 and neuropeptide-like protein nlp-8 (PubMed:27546573).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006084_AF2.pdb

hor006084_ESM.pdb

Mass:	201190	Formula:	C75H124N24O23S
Absent amino acids:	CEGHKNQVWY	Common amino acids:	R
pI:	10.32	Basic residues:	3
Polar residues:	3	Hydrophobic residues:	4
Hydrophobicity:	-74.67	Boman Index:	-5459
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	58.67
Instability Index:	5928	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 9685599
Title: FMRFamide-related gene family in the nematode, Caenorhabditis elegans.
PubMed ID: 9851916
Title: Genome sequence of the nematode C. elegans: a platform for investigating biology.
PubMed ID: 16061202
Title: Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.
PubMed ID: 11527423
Title: Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.
PubMed ID: 9070852
Title: APEASPFIRFamide, a novel FMRFamide-related decapeptide from Caenorhabditis elegans: structure and myoactivity.
PubMed ID: 15236235
Title: Expression and regulation of an FMRFamide-related neuropeptide gene family in Caenorhabditis elegans.
PubMed ID: 16187307
Title: Role of a FMRFamide-like family of neuropeptides in the pharyngeal nervous system of Caenorhabditis elegans.
PubMed ID: 16377032
Title: FMRFamide related peptide ligands activate the Caenorhabditis elegans orphan GPCR Y59H11AL.1.
PubMed ID: 27546573
Title: C. elegans Stress-Induced Sleep Emerges from the Collective Action of Multiple Neuropeptides.
PubMed ID: 28094002
Title: The RFamide receptor DMSR-1 regulates stress-induced sleep in C. elegans.